0
Your Cart

IGF LR3 (Long arginine 3-IGF-1) – High-Quality Research Peptide

Long arginine 3-IGF-1 (IGF-1 LR3), offered is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: IGF LR3
  • Catalogue Number: IGF1LR3
  • Molecular Weight: 9117.60 gmol
  • Purity: ≥98%
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Form: Lyophilised Solid

Usage and Storage:

Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

Long arginine 3-IGF-1 (IGF-1 LR3) is strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application.

If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research, explore our range of peptides designed for scientific rigour and innovation.

Options

0.1mg*10vials, 1mg*10vials

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.